![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
![]() | Protein automated matches [191287] (2 species) not a true protein |
![]() | Species Yersinia pseudotuberculosis [TaxId:502800] [189934] (1 PDB entry) |
![]() | Domain d2y6tf_: 2y6t F: [170657] Other proteins in same PDB: d2y6ta_, d2y6tb_, d2y6tc_, d2y6td_ automated match to d1ecya_ complexed with so4 |
PDB Entry: 2y6t (more details), 2.74 Å
SCOPe Domain Sequences for d2y6tf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y6tf_ b.16.1.1 (F:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]} nqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnlet rtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvp qgvevkyriweagedirsaqvk
Timeline for d2y6tf_: