Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries) Uniprot P00766 |
Domain d2y6tc_: 2y6t C: [170654] Other proteins in same PDB: d2y6te_, d2y6tf_, d2y6tg_, d2y6th_ automated match to d1acbe_ complexed with so4 |
PDB Entry: 2y6t (more details), 2.74 Å
SCOPe Domain Sequences for d2y6tc_:
Sequence, based on SEQRES records: (download)
>d2y6tc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
>d2y6tc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp sasddfaagttcvttgwgltrytantpdrlqqaslpllsntnckkywgtkikdamicaga sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d2y6tc_: