SCOPe 2.05: Domain d2y6ca_: 2y6c A:

Lineage for d2y6ca_ (2y6c A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (32 PDB entries)

8. Domain d2y6ca_: 2y6c A: [170650]
   automated match to d1mmra_
   complexed with ca, so4, tqi, zn

Details for d2y6ca_

PDB Entry: 2y6c, 1.7 Å

PDB Description: the discovery of mmp7 inhibitors exploiting a novel selectivity trigger

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2y6ca_:

Sequence, based on SEQRES records:

>d2y6ca_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtad
imigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaat
helghslgmghssdpnavmyptygngdpqnfklsqddikgiqkly

Sequence, based on observed residues (ATOM records):

>d2y6ca_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtad
imigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaat
helghslgmghssdpnavmyptypqnfklsqddikgiqkly

Timeline for d2y6ca_:

• d2y6ca_ first appeared in SCOPe 2.01
  
• d2y6ca_ appears in SCOPe 2.04
  
• d2y6ca_ is called d2y6ca1 in SCOPe 2.06
  
• d2y6ca_ appears in the current release, SCOPe 2.08, called d2y6ca1