Lineage for d2y6ba_ (2y6b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333414Protein automated matches [190089] (9 species)
    not a true protein
  7. 2333467Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 2333483Domain d2y6ba_: 2y6b A: [170649]
    automated match to d1oafa_
    complexed with hem, so4; mutant

Details for d2y6ba_

PDB Entry: 2y6b (more details), 1.9 Å

PDB Description: ascorbate peroxidase r38k mutant
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2y6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y6ba_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlklawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d2y6ba_:

Click to download the PDB-style file with coordinates for d2y6ba_.
(The format of our PDB-style files is described here.)

Timeline for d2y6ba_: