Lineage for d2y69y_ (2y69 Y:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957720Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 1957721Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 1957776Protein automated matches [191231] (1 species)
    not a true protein
  7. 1957777Species Cow (Bos taurus) [TaxId:9913] [189652] (1 PDB entry)
  8. 1957779Domain d2y69y_: 2y69 Y: [170647]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69z_
    automated match to d1occl_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69y_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (Y:) Cytochrome c oxidase subunit 7C

SCOPe Domain Sequences for d2y69y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69y_ f.23.6.1 (Y:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d2y69y_:

Click to download the PDB-style file with coordinates for d2y69y_.
(The format of our PDB-style files is described here.)

Timeline for d2y69y_: