Lineage for d2y69p_ (2y69 P:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457734Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1457735Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1457736Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1457749Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1457750Species Cow (Bos taurus) [TaxId:9913] [81444] (24 PDB entries)
  8. 1457766Domain d2y69p_: 2y69 P: [170643]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69d_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69n_, d2y69o1, d2y69o2, d2y69q_, d2y69t_, d2y69u_, d2y69v_, d2y69y_
    automated match to d1occc_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69p_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d2y69p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d2y69p_:

Click to download the PDB-style file with coordinates for d2y69p_.
(The format of our PDB-style files is described here.)

Timeline for d2y69p_: