Lineage for d1b0na2 (1b0n A:1-68)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709494Protein SinR repressor, DNA-binding domain [47433] (1 species)
  7. 2709495Species Bacillus subtilis [TaxId:1423] [47434] (1 PDB entry)
  8. 2709496Domain d1b0na2: 1b0n A:1-68 [17064]
    Other proteins in same PDB: d1b0na1, d1b0nb_
    CASP3
    complexed with zn

Details for d1b0na2

PDB Entry: 1b0n (more details), 1.9 Å

PDB Description: sinr protein/sini protein complex
PDB Compounds: (A:) protein (sinr protein)

SCOPe Domain Sequences for d1b0na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht
lldekhet

SCOPe Domain Coordinates for d1b0na2:

Click to download the PDB-style file with coordinates for d1b0na2.
(The format of our PDB-style files is described here.)

Timeline for d1b0na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0na1
View in 3D
Domains from other chains:
(mouse over for more information)
d1b0nb_