Lineage for d2y69a_ (2y69 A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457625Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1457626Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1457627Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1457687Protein automated matches [190134] (3 species)
    not a true protein
  7. 1457688Species Cow (Bos taurus) [TaxId:9913] [187061] (17 PDB entries)
  8. 1457699Domain d2y69a_: 2y69 A: [170636]
    Other proteins in same PDB: d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69t_, d2y69u_, d2y69v_, d2y69y_
    automated match to d1occa_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69a_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2y69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69a_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah
afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag
agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt
plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp
evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt
rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans
sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv
nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre
vltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d2y69a_:

Click to download the PDB-style file with coordinates for d2y69a_.
(The format of our PDB-style files is described here.)

Timeline for d2y69a_: