SCOPe 2.01: Domain d2y63a_: 2y63 A:

Lineage for d2y63a_ (2y63 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51360] (8 PDB entries)

8. Domain d2y63a_: 2y63 A: [170635]
   automated match to d1amka_
   complexed with bbr

Details for d2y63a_

PDB Entry: 2y63, 1.97 Å

PDB Description: crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2y63a_:

Sequence; same for both SEQRES and ATOM records:

>d2y63a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
frdiidatr

Timeline for d2y63a_:

• d2y63a_ is new in SCOPe 2.01-stable
  
• d2y63a_ appears in SCOPe 2.02
  
• d2y63a_ appears in the current release, SCOPe 2.08