Lineage for d2y5sb_ (2y5s B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089825Family c.1.21.0: automated matches [191656] (1 protein)
    not a true family
  6. 2089826Protein automated matches [191224] (3 species)
    not a true protein
  7. 2089827Species Burkholderia cenocepacia [TaxId:95486] [189624] (2 PDB entries)
  8. 2089829Domain d2y5sb_: 2y5s B: [170632]
    Other proteins in same PDB: d2y5sa2
    automated match to d1aj0a_
    complexed with 78h, cl, edo

Details for d2y5sb_

PDB Entry: 2y5s (more details), 1.95 Å

PDB Description: Crystal structure of Burkholderia cenocepacia dihydropteroate synthase complexed with 7,8-dihydropteroate.
PDB Compounds: (B:) dihydropteroate synthase

SCOPe Domain Sequences for d2y5sb_:

Sequence, based on SEQRES records: (download)

>d2y5sb_ c.1.21.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 95486]}
stflpaplqcgrfeltferplvmgilnatpdsfsdggrflarddalrraermiaegadll
diggestrpgappvpldeelarviplvealrplnvplsidtykpavmraalaagadlind
iwgfrqpgaidavrdgnsglcamhmlgepqtmqvgepdygdvvtdvrdflaaraqalrda
gvaaericvdpgfgfgkavvddnyallaalpdtaparpdgraypilagmsrksmlgavig
gkpplervaasvaaalcavergaaivrvhdvaatvdalsvwnavraaarqr

Sequence, based on observed residues (ATOM records): (download)

>d2y5sb_ c.1.21.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 95486]}
stflpaplqcgrfeltferplvmgilnatparddalrraermiaegadlldiggestrpg
appvpldeelarviplvealrplnvplsidtykpavmraalaagadlindiwgfrqpgai
davrdgnsglcamhmlgepqtmqvgepdygdvvtdvrdflaaraqalrdagvaaericvd
pgfgfgkavvddnyallaalpdtaparpdgraypilagmsrksmlgaviggkpplervaa
svaaalcavergaaivrvhdvaatvdalsvwnavraaarqr

SCOPe Domain Coordinates for d2y5sb_:

Click to download the PDB-style file with coordinates for d2y5sb_.
(The format of our PDB-style files is described here.)

Timeline for d2y5sb_: