![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein Ner [47430] (1 species) |
![]() | Species Bacteriophage mu [TaxId:10677] [47431] (2 PDB entries) |
![]() | Domain d1neqa_: 1neq A: [17063] |
PDB Entry: 1neq (more details)
SCOP Domain Sequences for d1neqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1neqa_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet kpeviwpsryqage
Timeline for d1neqa_: