Lineage for d1neqa_ (1neq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709338Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2709399Protein Ner [47430] (1 species)
  7. 2709400Species Bacteriophage Mu [TaxId:10677] [47431] (2 PDB entries)
  8. 2709402Domain d1neqa_: 1neq A: [17063]

Details for d1neqa_

PDB Entry: 1neq (more details)

PDB Description: solution structure of the mu ner protein by multidimensional nmr
PDB Compounds: (A:) DNA-binding protein ner

SCOPe Domain Sequences for d1neqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neqa_ a.35.1.2 (A:) Ner {Bacteriophage Mu [TaxId: 10677]}
csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
kpeviwpsryqage

SCOPe Domain Coordinates for d1neqa_:

Click to download the PDB-style file with coordinates for d1neqa_.
(The format of our PDB-style files is described here.)

Timeline for d1neqa_: