Lineage for d1ner__ (1ner -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537329Protein Ner [47430] (1 species)
  7. 537330Species Bacteriophage mu [TaxId:10677] [47431] (2 PDB entries)
  8. 537331Domain d1ner__: 1ner - [17062]

Details for d1ner__

PDB Entry: 1ner (more details)

PDB Description: solution structure of the mu ner protein by multidimensional nmr

SCOP Domain Sequences for d1ner__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ner__ a.35.1.2 (-) Ner {Bacteriophage mu}
csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
kpeviwpsryqage

SCOP Domain Coordinates for d1ner__:

Click to download the PDB-style file with coordinates for d1ner__.
(The format of our PDB-style files is described here.)

Timeline for d1ner__: