Lineage for d1ner__ (1ner -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3053Protein Ner [47430] (1 species)
  7. 3054Species Bacteriophage mu [TaxId:10677] [47431] (2 PDB entries)
  8. 3055Domain d1ner__: 1ner - [17062]

Details for d1ner__

PDB Entry: 1ner (more details)

PDB Description: solution structure of the mu ner protein by multidimensional nmr

SCOP Domain Sequences for d1ner__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ner__ a.35.1.2 (-) Ner {Bacteriophage mu}
csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
kpeviwpsryqage

SCOP Domain Coordinates for d1ner__:

Click to download the PDB-style file with coordinates for d1ner__.
(The format of our PDB-style files is described here.)

Timeline for d1ner__: