Lineage for d2y5ja1 (2y5j A:4-292)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089825Family c.1.21.0: automated matches [191656] (1 protein)
    not a true family
  6. 2089826Protein automated matches [191224] (3 species)
    not a true protein
  7. 2089827Species Burkholderia cenocepacia [TaxId:95486] [189624] (2 PDB entries)
  8. 2089830Domain d2y5ja1: 2y5j A:4-292 [170618]
    Other proteins in same PDB: d2y5ja2
    automated match to d1aj0a_
    complexed with edo

Details for d2y5ja1

PDB Entry: 2y5j (more details), 2.33 Å

PDB Description: Crystal structure of Burkholderia cenocepacia dihydropteroate synthase.
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d2y5ja1:

Sequence, based on SEQRES records: (download)

>d2y5ja1 c.1.21.0 (A:4-292) automated matches {Burkholderia cenocepacia [TaxId: 95486]}
flpaplqcgrfeltferplvmgilnatpdsfsdggrflarddalrraermiaegadlldi
ggestrpgappvpldeelarviplvealrplnvplsidtykpavmraalaagadlindiw
gfrqpgaidavrdgnsglcamhmlgepqtmqvgepdygdvvtdvrdflaaraqalrdagv
aaericvdpgfgfgkavvddnyallaalpdtaparpdgraypilagmsrksmlgaviggk
pplervaasvaaalcavergaaivrvhdvaatvdalsvwnavraaarqr

Sequence, based on observed residues (ATOM records): (download)

>d2y5ja1 c.1.21.0 (A:4-292) automated matches {Burkholderia cenocepacia [TaxId: 95486]}
flpaplqcgrfeltferplvmgilnarddalrraermiaegadlldigppvpldeelarv
iplvealrplnvplsidtykpavmraalaagadlindiwgfrqpgaidavrdgnsglcam
hmlgepqtmqvgepdygdvvtdvrdflaaraqalrdagvaaericvdpgfgfgkavvddn
yallaalpdtaparpdgraypilagmsrksmlgaviggkpplervaasvaaalcaverga
aivrvhdvaatvdalsvwnavraaarqr

SCOPe Domain Coordinates for d2y5ja1:

Click to download the PDB-style file with coordinates for d2y5ja1.
(The format of our PDB-style files is described here.)

Timeline for d2y5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2y5ja2