![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries) |
![]() | Domain d2y5ha_: 2y5h A: [170614] Other proteins in same PDB: d2y5hl_ automated match to d2boka1 complexed with na, y5h |
PDB Entry: 2y5h (more details), 1.33 Å
SCOPe Domain Sequences for d2y5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5ha_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d2y5ha_: