SCOPe 2.07: Domain d2y5ga_: 2y5g A:

Lineage for d2y5ga_ (2y5g A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d2y5ga_: 2y5g A: [170612]
   Other proteins in same PDB: d2y5gl_
   automated match to d2boka1
   complexed with fjd, na

Details for d2y5ga_

PDB Entry: 2y5g, 1.29 Å

PDB Description: factor xa - cation inhibitor complex

PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2y5ga_:

Sequence; same for both SEQRES and ATOM records:

>d2y5ga_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

Timeline for d2y5ga_:

• d2y5ga_ first appeared in SCOPe 2.01
  
• d2y5ga_ appears in SCOPe 2.06
  
• d2y5ga_ appears in the current release, SCOPe 2.08