| Class b: All beta proteins [48724] (174 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
| Protein automated matches [190044] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries) |
| Domain d2y5ga_: 2y5g A: [170612] Other proteins in same PDB: d2y5gl_ automated match to d2boka1 complexed with fjd, na |
PDB Entry: 2y5g (more details), 1.29 Å
SCOPe Domain Sequences for d2y5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5ga_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d2y5ga_: