Lineage for d3orca_ (3orc A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768024Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 768044Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 768045Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)
  8. 768051Domain d3orca_: 3orc A: [17061]
    engineered cro monomer bound nonspecifically to DNA
    protein/DNA complex; mutant

Details for d3orca_

PDB Entry: 3orc (more details), 3 Å

PDB Description: crystal structure of an engineered cro monomer bound nonspecifically to dna
PDB Compounds: (A:) protein (cro repressor)

SCOP Domain Sequences for d3orca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orca_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgevk
pfpsn

SCOP Domain Coordinates for d3orca_:

Click to download the PDB-style file with coordinates for d3orca_.
(The format of our PDB-style files is described here.)

Timeline for d3orca_: