Lineage for d2y5cb1 (2y5c B:4-109)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934260Species Human (Homo sapiens) [TaxId:9606] [189894] (1 PDB entry)
  8. 2934262Domain d2y5cb1: 2y5c B:4-109 [170609]
    Other proteins in same PDB: d2y5ca2, d2y5cb2
    automated match to d1l6ua_
    complexed with fes, so4

Details for d2y5cb1

PDB Entry: 2y5c (more details), 1.7 Å

PDB Description: Structure of human ferredoxin 2 (Fdx2)in complex with 2Fe2S cluster
PDB Compounds: (B:) adrenodoxin-like protein, mitochondrial

SCOPe Domain Sequences for d2y5cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5cb1 d.15.4.0 (B:4-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhldl
lpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr

SCOPe Domain Coordinates for d2y5cb1:

Click to download the PDB-style file with coordinates for d2y5cb1.
(The format of our PDB-style files is described here.)

Timeline for d2y5cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2y5cb2