![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189894] (1 PDB entry) |
![]() | Domain d2y5cb1: 2y5c B:4-109 [170609] Other proteins in same PDB: d2y5ca2, d2y5cb2 automated match to d1l6ua_ complexed with fes, so4 |
PDB Entry: 2y5c (more details), 1.7 Å
SCOPe Domain Sequences for d2y5cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5cb1 d.15.4.0 (B:4-109) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhldl lpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr
Timeline for d2y5cb1: