Lineage for d2y5be_ (2y5b E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)
  8. 2155487Domain d2y5be_: 2y5b E: [170607]
    Other proteins in same PDB: d2y5bb1, d2y5bb2, d2y5bf1, d2y5bf2
    automated match to d2ibia1
    complexed with so4, zn

Details for d2y5be_

PDB Entry: 2y5b (more details), 2.7 Å

PDB Description: Structure of USP21 in complex with linear diubiquitin-aldehyde
PDB Compounds: (E:) Ubiquitin carboxyl-terminal hydrolase 21

SCOPe Domain Sequences for d2y5be_:

Sequence, based on SEQRES records: (download)

>d2y5be_ d.3.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhtlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqeltea
fadvigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrg
rrappilangpvpspprrggalleepelsdddranlmwkryleredskivdlfvgqlksc
lkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenapvcdrcr
qktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasdkagspv
yqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfyqlmq

Sequence, based on observed residues (ATOM records): (download)

>d2y5be_ d.3.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhtlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqeraqelteafadvi
galwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgeepel
sdddranlmwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkgkv
slrdcfnlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsik
kssvgvdfplqrlslgdfasdkagspvyqlyalcnhsgsvhyghytalcrcqtgwhvynd
srvspvsenqvassegyvlfyqlmq

SCOPe Domain Coordinates for d2y5be_:

Click to download the PDB-style file with coordinates for d2y5be_.
(The format of our PDB-style files is described here.)

Timeline for d2y5be_: