Lineage for d2y5ba_ (2y5b A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889773Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1889774Protein automated matches [190230] (17 species)
    not a true protein
  7. 1889788Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1889829Domain d2y5ba_: 2y5b A: [170606]
    Other proteins in same PDB: d2y5bb1, d2y5bb2, d2y5bf1, d2y5bf2
    automated match to d2ibia1
    complexed with so4, zn

Details for d2y5ba_

PDB Entry: 2y5b (more details), 2.7 Å

PDB Description: Structure of USP21 in complex with linear diubiquitin-aldehyde
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 21

SCOPe Domain Sequences for d2y5ba_:

Sequence, based on SEQRES records: (download)

>d2y5ba_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
htlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteaf
advigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgr
rappilangpvpspprrggalleepelsdddranlmwkryleredskivdlfvgqlkscl
kcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenapvcdrcrq
ktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasdkagspvy
qlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfyqlm

Sequence, based on observed residues (ATOM records): (download)

>d2y5ba_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
htlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevraqelteafadvi
galwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrsdddra
nlmwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkkvslrdcf
nlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgv
dfplqrlslgdfasdspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsen
qvassegyvlfyqlm

SCOPe Domain Coordinates for d2y5ba_:

Click to download the PDB-style file with coordinates for d2y5ba_.
(The format of our PDB-style files is described here.)

Timeline for d2y5ba_: