Lineage for d2y4za_ (2y4z A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739496Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1739497Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1739498Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1739629Protein automated matches [190369] (6 species)
    not a true protein
  7. 1739668Species Murine leukemia virus [TaxId:11786] [189823] (1 PDB entry)
  8. 1739669Domain d2y4za_: 2y4z A: [170604]
    automated match to d1u7ka_
    complexed with gol; mutant

Details for d2y4za_

PDB Entry: 2y4z (more details), 2 Å

PDB Description: structure of the amino-terminal capsid restriction escape mutation n-mlv l10w
PDB Compounds: (A:) capsid protein p30

SCOPe Domain Sequences for d2y4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y4za_ a.73.1.1 (A:) automated matches {Murine leukemia virus [TaxId: 11786]}
plrlggngqwqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllaglqnagrsleh

SCOPe Domain Coordinates for d2y4za_:

Click to download the PDB-style file with coordinates for d2y4za_.
(The format of our PDB-style files is described here.)

Timeline for d2y4za_: