| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein automated matches [190369] (6 species) not a true protein |
| Species Murine leukemia virus [TaxId:11786] [189823] (1 PDB entry) |
| Domain d2y4za_: 2y4z A: [170604] automated match to d1u7ka_ complexed with gol; mutant |
PDB Entry: 2y4z (more details), 2 Å
SCOPe Domain Sequences for d2y4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y4za_ a.73.1.1 (A:) automated matches {Murine leukemia virus [TaxId: 11786]}
plrlggngqwqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllaglqnagrsleh
Timeline for d2y4za_: