SCOPe 2.07: Domain d2y4za1: 2y4z A:1-132

Lineage for d2y4za1 (2y4z A:1-132)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)

6. Protein automated matches [190369] (7 species)
   not a true protein

7. Species Murine leukemia virus [TaxId:11786] [189823] (1 PDB entry)

8. Domain d2y4za1: 2y4z A:1-132 [170604]
   Other proteins in same PDB: d2y4za2
   automated match to d1u7ka_
   complexed with gol; mutant

Details for d2y4za1

PDB Entry: 2y4z, 2 Å

PDB Description: structure of the amino-terminal capsid restriction escape mutation n-mlv l10w

PDB Compounds: (A:) capsid protein p30

SCOPe Domain Sequences for d2y4za1:

Sequence; same for both SEQRES and ATOM records:

>d2y4za1 a.73.1.1 (A:1-132) automated matches {Murine leukemia virus [TaxId: 11786]}
plrlggngqwqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllaglqnagrs

Timeline for d2y4za1:

• d2y4za1 first appeared in SCOPe 2.01, called d2y4za_
  
• d2y4za1 appears in SCOPe 2.06