![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein automated matches [190369] (8 species) not a true protein |
![]() | Species Murine leukemia virus [TaxId:11786] [189823] (1 PDB entry) |
![]() | Domain d2y4za1: 2y4z A:1-132 [170604] Other proteins in same PDB: d2y4za2 automated match to d1u7ka_ complexed with gol; mutant |
PDB Entry: 2y4z (more details), 2 Å
SCOPe Domain Sequences for d2y4za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y4za1 a.73.1.1 (A:1-132) automated matches {Murine leukemia virus [TaxId: 11786]} plrlggngqwqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq lllaglqnagrs
Timeline for d2y4za1: