Lineage for d2y4za1 (2y4z A:1-132)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718052Species Murine leukemia virus [TaxId:11786] [189823] (1 PDB entry)
  8. 2718053Domain d2y4za1: 2y4z A:1-132 [170604]
    Other proteins in same PDB: d2y4za2
    automated match to d1u7ka_
    complexed with gol; mutant

Details for d2y4za1

PDB Entry: 2y4z (more details), 2 Å

PDB Description: structure of the amino-terminal capsid restriction escape mutation n-mlv l10w
PDB Compounds: (A:) capsid protein p30

SCOPe Domain Sequences for d2y4za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y4za1 a.73.1.1 (A:1-132) automated matches {Murine leukemia virus [TaxId: 11786]}
plrlggngqwqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllaglqnagrs

SCOPe Domain Coordinates for d2y4za1:

Click to download the PDB-style file with coordinates for d2y4za1.
(The format of our PDB-style files is described here.)

Timeline for d2y4za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2y4za2