Lineage for d2y4jb_ (2y4j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133869Family c.68.1.18: MGS-like [142691] (2 protein domains)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 2133870Protein Mannosylglycerate synthase, MGS [142692] (1 species)
  7. 2133871Species Rhodothermus marinus [TaxId:29549] [142693] (9 PDB entries)
    Uniprot Q9RFR0 2-382
  8. 2133876Domain d2y4jb_: 2y4j B: [170592]
    automated match to d2bo4a1
    complexed with lac, na, trs

Details for d2y4jb_

PDB Entry: 2y4j (more details), 2.3 Å

PDB Description: mannosylglycerate synthase in complex with lactate
PDB Compounds: (B:) mannosylglycerate synthase

SCOPe Domain Sequences for d2y4jb_:

Sequence, based on SEQRES records: (download)

>d2y4jb_ c.68.1.18 (B:) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
dyaqqylyrmlgryryqaale

Sequence, based on observed residues (ATOM records): (download)

>d2y4jb_ c.68.1.18 (B:) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
ervrrrsdwgidtlytfvtvqqgvsiyecyipegkygglddlrtmlvecfaaiqslqhev
vgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreglrtc
qrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgydyaq
qylyrmlgryryqaale

SCOPe Domain Coordinates for d2y4jb_:

Click to download the PDB-style file with coordinates for d2y4jb_.
(The format of our PDB-style files is described here.)

Timeline for d2y4jb_: