SCOPe 2.08: Domain d1cope_: 1cop E:

Lineage for d1cope_ (1cop E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)

8. Domain d1cope_: 1cop E: [17059]
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1cope_

PDB Entry: 1cop

PDB Description: three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr

PDB Compounds: (E:) cro repressor

SCOPe Domain Sequences for d1cope_:

Sequence; same for both SEQRES and ATOM records:

>d1cope_ a.35.1.2 (E:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
nkktta

Timeline for d1cope_:

• d1cope_ first appeared (with stable ids) in SCOP 1.55
  
• d1cope_ appears in SCOPe 2.07