Lineage for d2y43a_ (2y43 A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245811Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1245812Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1245922Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 1245923Protein automated matches [190242] (2 species)
    not a true protein
  7. 1245924Species Human (Homo sapiens) [TaxId:9606] [189860] (2 PDB entries)
  8. 1245925Domain d2y43a_: 2y43 A: [170589]
    automated match to d1jm7b_
    complexed with zn

Details for d2y43a_

PDB Entry: 2y43 (more details), 1.8 Å

PDB Description: rad18 ubiquitin ligase ring domain structure
PDB Compounds: (A:) e3 ubiquitin-protein ligase rad18

SCOPe Domain Sequences for d2y43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y43a_ g.44.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwppglavmktiddllrcgicfeyfniamiipqcshnycslcirkflsyktqcptccvtv
tepdlknnrildelvkslnfarnhllqfa

SCOPe Domain Coordinates for d2y43a_:

Click to download the PDB-style file with coordinates for d2y43a_.
(The format of our PDB-style files is described here.)

Timeline for d2y43a_: