SCOPe 2.02: Domain d2y42c_: 2y42 C:

Lineage for d2y42c_ (2y42 C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (15 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [189081] (5 PDB entries)

8. Domain d2y42c_: 2y42 C: [170587]
   automated match to d1g2ua_
   complexed with bcn, mn, nad

Details for d2y42c_

PDB Entry: 2y42, 2.5 Å

PDB Description: Structure of Isopropylmalate dehydrogenase from Thermus thermophilus - complex with NADH and Mn

PDB Compounds: (C:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d2y42c_:

Sequence; same for both SEQRES and ATOM records:

>d2y42c_ c.77.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
smkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrk
gveeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplk
eeiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkh
vvsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnif
gdilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammle
hafglvelarkvedavakalletpppdlggsagteaftatvlrhlaaaaleh

Timeline for d2y42c_:

• d2y42c_ first appeared in SCOPe 2.01
  
• d2y42c_ appears in SCOPe 2.03
  
• d2y42c_ appears in the current release, SCOPe 2.08, called d2y42c1