![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
![]() | Protein automated matches [190072] (22 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [189081] (6 PDB entries) |
![]() | Domain d2y41a1: 2y41 A:1-345 [170583] Other proteins in same PDB: d2y41a2, d2y41a3, d2y41b2, d2y41b3 automated match to d1g2ua_ complexed with ipm, mn |
PDB Entry: 2y41 (more details), 2.2 Å
SCOPe Domain Sequences for d2y41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y41a1 c.77.1.1 (A:1-345) automated matches {Thermus thermophilus [TaxId: 274]} mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh afglvelarkvedavakalletpppdlggsagteaftatvlrhla
Timeline for d2y41a1: