SCOP 1.73: Domain d1copd_: 1cop D:

Lineage for d1copd_ (1cop D:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)

8. Domain d1copd_: 1cop D: [17058]

Details for d1copd_

PDB Entry: 1cop

PDB Description: three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr

PDB Compounds: (D:) cro repressor

SCOP Domain Sequences for d1copd_:

Sequence; same for both SEQRES and ATOM records:

>d1copd_ a.35.1.2 (D:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
nkktta

Timeline for d1copd_:

• d1copd_ first appeared (with stable ids) in SCOP 1.55
  
• d1copd_ appears in SCOP 1.71
  
• d1copd_ appears in SCOP 1.75
  
• d1copd_ appears in the current release, SCOPe 2.08