Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins) automatically mapped to Pfam PF05881 |
Protein automated matches [190813] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries) |
Domain d2y3xe_: 2y3x E: [170579] automated match to d2ilxa1 complexed with gol, so4 |
PDB Entry: 2y3x (more details), 2.1 Å
SCOPe Domain Sequences for d2y3xe_:
Sequence, based on SEQRES records: (download)
>d2y3xe_ d.61.1.3 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} flplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyfgk rppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltd qelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqgeav gelprgklyslgkgrwmlsltkkmevkaiftgyyg
>d2y3xe_ d.61.1.3 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} flplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfiseklelvsyfgkrppgv lhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltdqelql wpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqgeavgelpr gklyslgkgrwmlsltkkmevkaiftgyyg
Timeline for d2y3xe_: