Lineage for d2y3xb_ (2y3x B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956578Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2956583Protein automated matches [190813] (2 species)
    not a true protein
  7. 2956586Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries)
  8. 2956593Domain d2y3xb_: 2y3x B: [170578]
    automated match to d2ilxa1
    complexed with gol, so4

Details for d2y3xb_

PDB Entry: 2y3x (more details), 2.1 Å

PDB Description: Catalytic domain of mouse 2',3'-cyclic nucleotide 3'- phosphodiesterase, complexed with sulfate
PDB Compounds: (B:) 2', 3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d2y3xb_:

Sequence, based on SEQRES records: (download)

>d2y3xb_ d.61.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lekdflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvs
yfgkrppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqv
vltdqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsq
geavgelprgklyslgkgrwmlsltkkmevkaiftgyyg

Sequence, based on observed residues (ATOM records): (download)

>d2y3xb_ d.61.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lekdflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgeklelvsyfgk
rppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltd
qelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqgeav
gelprgklyslgkgrwmlsltkkmevkaiftgyyg

SCOPe Domain Coordinates for d2y3xb_:

Click to download the PDB-style file with coordinates for d2y3xb_.
(The format of our PDB-style files is described here.)

Timeline for d2y3xb_: