Lineage for d1d1la_ (1d1l A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322523Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2322543Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 2322544Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 2322548Domain d1d1la_: 1d1l A: [17057]
    complexed with so4; mutant

Details for d1d1la_

PDB Entry: 1d1l (more details), 2.1 Å

PDB Description: crystal structure of cro-f58w mutant
PDB Compounds: (A:) lambda cro repressor

SCOPe Domain Sequences for d1d1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1la_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpwps
n

SCOPe Domain Coordinates for d1d1la_:

Click to download the PDB-style file with coordinates for d1d1la_.
(The format of our PDB-style files is described here.)

Timeline for d1d1la_: