Lineage for d2y3nd_ (2y3n D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100143Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 1100144Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 1100160Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 1100161Protein automated matches [190928] (3 species)
    not a true protein
  7. 1100162Species Bacteroides cellulosolvens [TaxId:35825] [189868] (1 PDB entry)
  8. 1100164Domain d2y3nd_: 2y3n D: [170564]
    Other proteins in same PDB: d2y3na_, d2y3nc_
    automated match to d1ohzb_
    complexed with ca

Details for d2y3nd_

PDB Entry: 2y3n (more details), 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
PDB Compounds: (D:) cellulosomal family-48 processive glycoside hydrolase

SCOPe Domain Sequences for d2y3nd_:

Sequence, based on SEQRES records: (download)

>d2y3nd_ a.139.1.0 (D:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
mfvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyf
gktk

Sequence, based on observed residues (ATOM records): (download)

>d2y3nd_ a.139.1.0 (D:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
mfvklkgdlngdgvinmadvmilaqsfgkdgvinsddaiilaqyfgktk

SCOPe Domain Coordinates for d2y3nd_:

Click to download the PDB-style file with coordinates for d2y3nd_.
(The format of our PDB-style files is described here.)

Timeline for d2y3nd_: