Lineage for d2y3nc1 (2y3n C:4-173)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040342Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2040356Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2040439Protein automated matches [190248] (6 species)
    not a true protein
  7. 2040442Species Bacteroides cellulosolvens [TaxId:35825] [189867] (1 PDB entry)
  8. 2040444Domain d2y3nc1: 2y3n C:4-173 [170563]
    Other proteins in same PDB: d2y3na2, d2y3na3, d2y3nb1, d2y3nb2, d2y3nc2, d2y3nd1, d2y3nd2
    automated match to d1tyja1
    complexed with ca

Details for d2y3nc1

PDB Entry: 2y3n (more details), 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
PDB Compounds: (C:) cellulosomal scaffoldin

SCOPe Domain Sequences for d2y3nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3nc1 b.2.2.2 (C:4-173) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm
pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike
ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk

SCOPe Domain Coordinates for d2y3nc1:

Click to download the PDB-style file with coordinates for d2y3nc1.
(The format of our PDB-style files is described here.)

Timeline for d2y3nc1: