Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein automated matches [190248] (6 species) not a true protein |
Species Bacteroides cellulosolvens [TaxId:35825] [189867] (1 PDB entry) |
Domain d2y3nc1: 2y3n C:4-173 [170563] Other proteins in same PDB: d2y3na2, d2y3na3, d2y3nb1, d2y3nb2, d2y3nc2, d2y3nd1, d2y3nd2 automated match to d1tyja1 complexed with ca |
PDB Entry: 2y3n (more details), 1.9 Å
SCOPe Domain Sequences for d2y3nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y3nc1 b.2.2.2 (C:4-173) automated matches {Bacteroides cellulosolvens [TaxId: 35825]} gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk
Timeline for d2y3nc1: