| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
| Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
| Protein automated matches [190928] (7 species) not a true protein |
| Species Bacteroides cellulosolvens [TaxId:35825] [189868] (1 PDB entry) |
| Domain d2y3nb1: 2y3n B:2-66 [170562] Other proteins in same PDB: d2y3na1, d2y3na2, d2y3na3, d2y3nb2, d2y3nc1, d2y3nc2, d2y3nd2 automated match to d1ohzb_ complexed with ca |
PDB Entry: 2y3n (more details), 1.9 Å
SCOPe Domain Sequences for d2y3nb1:
Sequence, based on SEQRES records: (download)
>d2y3nb1 a.139.1.0 (B:2-66) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyfg
ktksa
>d2y3nb1 a.139.1.0 (B:2-66) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkaiekadlnndgvinsddaiilaqyfgktksa
Timeline for d2y3nb1: