Lineage for d2y3nb1 (2y3n B:2-66)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734507Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2734508Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2734526Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2734527Protein automated matches [190928] (7 species)
    not a true protein
  7. 2734537Species Bacteroides cellulosolvens [TaxId:35825] [189868] (1 PDB entry)
  8. 2734538Domain d2y3nb1: 2y3n B:2-66 [170562]
    Other proteins in same PDB: d2y3na1, d2y3na2, d2y3na3, d2y3nb2, d2y3nc1, d2y3nc2, d2y3nd2
    automated match to d1ohzb_
    complexed with ca

Details for d2y3nb1

PDB Entry: 2y3n (more details), 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
PDB Compounds: (B:) cellulosomal family-48 processive glycoside hydrolase

SCOPe Domain Sequences for d2y3nb1:

Sequence, based on SEQRES records: (download)

>d2y3nb1 a.139.1.0 (B:2-66) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyfg
ktksa

Sequence, based on observed residues (ATOM records): (download)

>d2y3nb1 a.139.1.0 (B:2-66) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkaiekadlnndgvinsddaiilaqyfgktksa

SCOPe Domain Coordinates for d2y3nb1:

Click to download the PDB-style file with coordinates for d2y3nb1.
(The format of our PDB-style files is described here.)

Timeline for d2y3nb1: