Lineage for d2y3na_ (2y3n A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938452Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 938466Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 938531Protein automated matches [190248] (5 species)
    not a true protein
  7. 938534Species Bacteroides cellulosolvens [TaxId:35825] [189867] (1 PDB entry)
  8. 938535Domain d2y3na_: 2y3n A: [170561]
    Other proteins in same PDB: d2y3nb_, d2y3nd_
    automated match to d1tyja1
    complexed with ca

Details for d2y3na_

PDB Entry: 2y3n (more details), 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d2y3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3na_ b.2.2.2 (A:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
sgsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdst
mpdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvik
eipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypkle

SCOPe Domain Coordinates for d2y3na_:

Click to download the PDB-style file with coordinates for d2y3na_.
(The format of our PDB-style files is described here.)

Timeline for d2y3na_: