Lineage for d2y3na1 (2y3n A:4-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767323Protein automated matches [190248] (6 species)
    not a true protein
  7. 2767329Species Bacteroides cellulosolvens [TaxId:35825] [189867] (1 PDB entry)
  8. 2767330Domain d2y3na1: 2y3n A:4-173 [170561]
    Other proteins in same PDB: d2y3na2, d2y3na3, d2y3nb1, d2y3nb2, d2y3nc2, d2y3nd1, d2y3nd2
    automated match to d1tyja1
    complexed with ca

Details for d2y3na1

PDB Entry: 2y3n (more details), 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d2y3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3na1 b.2.2.2 (A:4-173) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm
pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike
ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk

SCOPe Domain Coordinates for d2y3na1:

Click to download the PDB-style file with coordinates for d2y3na1.
(The format of our PDB-style files is described here.)

Timeline for d2y3na1: