Lineage for d1d1ma_ (1d1m A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442288Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 442308Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 442309Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)
  8. 442326Domain d1d1ma_: 1d1m A: [17056]
    insertion mutant k56-[dgevk]-f58w

Details for d1d1ma_

PDB Entry: 1d1m (more details), 2.05 Å

PDB Description: crystal structure of cro k56-[dgevk]-f58w mutant

SCOP Domain Sequences for d1d1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ma_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpwps

SCOP Domain Coordinates for d1d1ma_:

Click to download the PDB-style file with coordinates for d1d1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d1mb_