SCOPe 2.06: Domain d2y3ea_: 2y3e A:

Lineage for d2y3ea_ (2y3e A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)

8. Domain d2y3ea_: 2y3e A: [170556]
   automated match to d1n9mc_
   complexed with gol

Details for d2y3ea_

PDB Entry: 2y3e, 1.45 Å

PDB Description: traptavidin, apo-form

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2y3ea_:

Sequence; same for both SEQRES and ATOM records:

>d2y3ea_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

Timeline for d2y3ea_:

• d2y3ea_ first appeared in SCOPe 2.01
  
• d2y3ea_ appears in SCOPe 2.05
  
• d2y3ea_ appears in SCOPe 2.07
  
• d2y3ea_ appears in the current release, SCOPe 2.08