Lineage for d2y37b_ (2y37 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683350Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1683351Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1683352Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1683973Protein automated matches [190421] (5 species)
    not a true protein
  7. 1684024Species Mouse (Mus musculus) [TaxId:10090] [187301] (7 PDB entries)
  8. 1684030Domain d2y37b_: 2y37 B: [170555]
    automated match to d1jwja_
    complexed with a54, gol, h4b, hem, so4

Details for d2y37b_

PDB Entry: 2y37 (more details), 2.6 Å

PDB Description: the discovery of novel, potent and highly selective inhibitors of inducible nitric oxide synthase (inos)
PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d2y37b_:

Sequence, based on SEQRES records: (download)

>d2y37b_ d.174.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Sequence, based on observed residues (ATOM records): (download)

>d2y37b_ d.174.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

SCOPe Domain Coordinates for d2y37b_:

Click to download the PDB-style file with coordinates for d2y37b_.
(The format of our PDB-style files is described here.)

Timeline for d2y37b_: