Lineage for d1d1mb_ (1d1m B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768024Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 768044Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 768045Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)
  8. 768063Domain d1d1mb_: 1d1m B: [17055]
    insertion mutant k56-[dgevk]-f58w

Details for d1d1mb_

PDB Entry: 1d1m (more details), 2.05 Å

PDB Description: crystal structure of cro k56-[dgevk]-f58w mutant
PDB Compounds: (B:) lambda cro repressor

SCOP Domain Sequences for d1d1mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1mb_ a.35.1.2 (B:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpwps

SCOP Domain Coordinates for d1d1mb_:

Click to download the PDB-style file with coordinates for d1d1mb_.
(The format of our PDB-style files is described here.)

Timeline for d1d1mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d1ma_