Lineage for d1d1mb_ (1d1m B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) 
Family a.35.1.2: Phage repressors [47419] (6 proteins) Protein cro lambda repressor [47428] (1 species) Species Bacteriophage lambda (Escherichia coli) [TaxId:10710] [47429] (9 PDB entries) 
Domain d1d1mb_: 1d1m B: [17055]
Details for d1d1mb_
PDB Entry: 1d1m (more details), 2.05 Å
PDB Description: crystal structure of cro k56-[dgevk]-f58w mutant
SCOP Domain Sequences for d1d1mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1mb_ a.35.1.2 (B:) cro lambda repressor {Bacteriophage lambda (Escherichia coli)}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpwps
SCOP Domain Coordinates for d1d1mb_:
Click to download the PDB-style file with coordinates for d1d1mb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d1mb_:
- d1d1mb_ appears in SCOP 1.57
- d1d1mb_ appears in the current release, SCOPe 2.08
View in 3D
