SCOPe 2.04: Domain d2y2eb_: 2y2e B:

Lineage for d2y2eb_ (2y2e B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein AmpD protein [82775] (1 species)

7. Species Citrobacter freundii [TaxId:546] [82776] (6 PDB entries)

8. Domain d2y2eb_: 2y2e B: [170548]
   automated match to d1j3ga_
   complexed with zn

Details for d2y2eb_

PDB Entry: 2y2e, 2 Å

PDB Description: crystal structure of ampd grown at ph 5.5

PDB Compounds: (B:) 1,6-anhydro-n-acetylmuramyl-l-alanine amidase ampd

SCOPe Domain Sequences for d2y2eb_:

Sequence; same for both SEQRES and ATOM records:

>d2y2eb_ d.118.1.1 (B:) AmpD protein {Citrobacter freundii [TaxId: 546]}
mlldegwlaearrvpsphydcrpddenpsllvvhnislppgefggpwidalftgtidpna
hpyfagiahlrvsahclirrdgeivqyvpfdkrawhagvssyqgrercndfsigielegt
dtlaytdaqyqqlaavtnalitrypaiannmtghcniaperktdpgpsfdwarfralvt

Timeline for d2y2eb_:

• d2y2eb_ first appeared in SCOPe 2.01
  
• d2y2eb_ appears in SCOPe 2.03
  
• d2y2eb_ appears in SCOPe 2.05
  
• d2y2eb_ appears in the current release, SCOPe 2.08