![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
![]() | Superfamily a.274.1: HAMP domain-like [158472] (1 family) ![]() automatically mapped to Pfam PF00672 |
![]() | Family a.274.1.1: HAMP domain [158473] (2 proteins) Pfam PF00672 |
![]() | Protein automated matches [191239] (1 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries) |
![]() | Domain d2y21e_: 2y21 E: [170527] Other proteins in same PDB: d2y21b2, d2y21d2, d2y21f2, d2y21j2, d2y21l2 automated match to d2aswa1 mutant |
PDB Entry: 2y21 (more details), 2.45 Å
SCOPe Domain Sequences for d2y21e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y21e_ a.274.1.1 (E:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} stitrpiielsntvdkiaegnleaevphqnradeigilaksierlrrslkvame
Timeline for d2y21e_: