Lineage for d2y21c_ (2y21 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928931Fold a.274: HAMP domain-like [158471] (1 superfamily)
    dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections
  4. 928932Superfamily a.274.1: HAMP domain-like [158472] (1 family) (S)
  5. 928933Family a.274.1.1: HAMP domain [158473] (2 proteins)
    Pfam PF00672
  6. 928938Protein automated matches [191239] (1 species)
    not a true protein
  7. 928939Species Archaeoglobus fulgidus [TaxId:2234] [189690] (4 PDB entries)
  8. 928954Domain d2y21c_: 2y21 C: [170525]
    automated match to d2aswa1
    mutant

Details for d2y21c_

PDB Entry: 2y21 (more details), 2.45 Å

PDB Description: the mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d2y21c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y21c_ a.274.1.1 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
itrpiielsntvdkiaegnleaevphqnradeigilaksierlrrslkvame

SCOPe Domain Coordinates for d2y21c_:

Click to download the PDB-style file with coordinates for d2y21c_.
(The format of our PDB-style files is described here.)

Timeline for d2y21c_: