Lineage for d4croe_ (4cro E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537296Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 537297Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)
  8. 537310Domain d4croe_: 4cro E: [17052]

Details for d4croe_

PDB Entry: 4cro (more details), 3.9 Å

PDB Description: protein-dna conformational changes in the crystal structure of a lambda cro-operator complex

SCOP Domain Sequences for d4croe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4croe_ a.35.1.2 (E:) cro lambda repressor {Bacteriophage lambda}
qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
ktta

SCOP Domain Coordinates for d4croe_:

Click to download the PDB-style file with coordinates for d4croe_.
(The format of our PDB-style files is described here.)

Timeline for d4croe_: